PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_27730
Common NameKK1_031199
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 125aa    MW: 14942.4 Da    PI: 10.1314
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_27730genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK78.57.4e-25249552
         RWP-RK  5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                   +s +++s+yF++pi +AA+eL+v+lT LK++CR++GI+RWP+Rk+ sl
  C.cajan_27730  2 LSRKTVSEYFYMPISQAARELNVGLTHLKKRCRELGIQRWPQRKLMSL 49
                   68899****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.177169IPR003035RWP-RK domain
PfamPF020428.3E-21249IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MLSRKTVSEY FYMPISQAAR ELNVGLTHLK KRCRELGIQR WPQRKLMSLQ TLIKKIQDQI  60
EGYENDEKIR AAIEVLEREK RMVEEMPDLQ LDDNTRRLRQ ACLKANYKKR RLMGMHEVHE  120
TTISP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006578571.17e-66PREDICTED: protein RKD1-like
RefseqXP_014632622.15e-67PREDICTED: protein RKD1-like
SwissprotQ9M9U94e-50RKD1_ARATH; Protein RKD1
TrEMBLA0A151RX947e-89A0A151RX94_CAJCA; Uncharacterized protein
STRINGGLYMA04G33516.12e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-51RWP-RK domain-containing protein